PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0428s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 302aa    MW: 32223.8 Da    PI: 9.5653
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0428s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3951110362
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk k++s
  SapurV1A.0428s0050.1.p  51 QENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKTKSTS 110
                             7889****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2651107IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3252108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.37654108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MIQELFGGAG LIGGERKIPI NATILEGAPS PSLSSKTTTT PAPNSTPSSA QENLRCPRCD  60
SSNTKFCYYN NYNLTQPRHF CKTCRRYWTK GGALRNVPIG GGCRKTKSTS VSASAGKSCT  120
NKIKTMASEF GRSGFGNGFD HELSSSSIMQ ASPQNSHIFA LLRATLNPNP STLRNSISVI  180
GNHMISEPAA ETAPWNARTL GLDPISQVSS SPSWKSNQHQ QNGFTVGEAQ NTGIQELYQR  240
LRSSTNYYTD NPSAIVRSNV TIPSSTSSTI LGSAPVAGGE LGYWNPAFSW SDLPTTNGAY  300
P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1447491e-127EF144749.1 Populus trichocarpa clone WS01117_M16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310753.11e-157hypothetical protein POPTR_0007s11620g
TrEMBLA9P9B51e-157A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-34DOF zinc finger protein 1